Protein Info for b2500 in Escherichia coli BW25113

Name: purN
Annotation: phosphoribosylglycinamide formyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00551: Formyl_trans_N
  • amino acids 1 to 181 (181 residues), 235.8 bits, E=1.5e-74
• TIGR00639: phosphoribosylglycinamide formyltransferase
  • amino acids 1 to 191 (191 residues), 280.8 bits, E=2.3e-88

Best Hits

Swiss-Prot: 100% identical to PUR3_ECOLI: Phosphoribosylglycinamide formyltransferase (purN) from Escherichia coli (strain K12)

KEGG orthology group: K11175, phosphoribosylglycinamide formyltransferase 1 [EC: 2.1.2.2] (inferred from 100% identity to eco:b2500)

MetaCyc: 100% identical to phosphoribosylglycinamide formyltransferase 1 (Escherichia coli K-12 substr. MG1655)
Phosphoribosylglycinamide formyltransferase. [EC: 2.1.2.2]

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2

Use Curated BLAST to search for 2.1.2.2

Sequence Analysis Tools

See P08179 at UniProt or InterPro

Protein Sequence (212 amino acids)

>b2500 phosphoribosylglycinamide formyltransferase (NCBI) (Escherichia coli BW25113)
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASA
FDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHT
HRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLV
ISWFADGRLKMHENAAWLDGQRLPPQGYAADE