Protein Info for b2486 in Escherichia coli BW25113

Name: hyfF
Annotation: NADH dehydrogenase subunit N (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details amino acids 352 to 354 (3 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details amino acids 457 to 477 (21 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 68 to 101 (34 residues), 26.4 bits, see alignment (E = 5.1e-10) PF00361: Proton_antipo_M" amino acids 132 to 425 (294 residues), 191 bits, see alignment E=2.8e-60

Best Hits

Swiss-Prot: 100% identical to HYFF_ECOLI: Hydrogenase-4 component F (hyfF) from Escherichia coli (strain K12)

KEGG orthology group: K12141, hydrogenase-4 component F [EC: 1.-.-.-] (inferred from 100% identity to eco:b2486)

Predicted SEED Role

"Hydrogenase-4 component F"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77437 at UniProt or InterPro

Protein Sequence (526 amino acids)

>b2486 NADH dehydrogenase subunit N (NCBI) (Escherichia coli BW25113)
MSYSVMFALLLLTPLLFSLLCFACRKRRLSATRTVTVLHSLGITLLLILALWVVQTAADA
GEIFAAGLWLHIDGLGGLFLAILGVIGFLTGIYSIGYMRHEVAHGELSPVTLCDYYGFFH
LFLFTMLLVVTSNNLIVMWAAIEATTLSSAFLVGIYGQRSSLEAAWKYIIICTVGVAFGL
FGTVLVYANAASVMPQAEMAIFWSEVLKQSSLLDPTLMLLAFVFLLIGFGTKTGLFPMHA
WLPDAHSEAPSPVSALLSAVLLNCALLVLIRYYIIICQAIGSDFPNRLLLIFGMLSVAVA
AFFILVQRDIKRLLAYSSVENMGLVAVELGIGGPLGIFAALLHILNHSLAKTLLFCGSGN
VLLKYGTRDLNVVCGMLKIMPFTAVLFGGGALALAGMPPFNIFLSEFMTITAGLARNHLL
IIVLLLLLLTLVLAGLVRMAARVLMAKPPQAVNRGDLGWLTTSPMVILLVMMLAMGTHIP
QPVIRILAGASTIVLSGTHDLPAQRSTWHDFLPSGTASVSEKHSER