Protein Info for b2481 in Escherichia coli BW25113

Name: hyfA
Annotation: hydrogenase 4 Fe-S subunit (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF12800: Fer4_4" amino acids 11 to 23 (13 residues), 12.9 bits, see alignment (E = 8.1e-05) amino acids 80 to 95 (16 residues), 18.9 bits, see alignment (E = 9.4e-07) PF13247: Fer4_11" amino acids 46 to 98 (53 residues), 28.7 bits, see alignment E=8.3e-10 PF25160: LdpA_Fe-S-bd" amino acids 56 to 100 (45 residues), 30.7 bits, see alignment 1.4e-10 PF00037: Fer4" amino acids 76 to 98 (23 residues), 36 bits, see alignment (E = 2.7e-12) PF12837: Fer4_6" amino acids 78 to 97 (20 residues), 28.6 bits, see alignment (E = 6.4e-10) PF13187: Fer4_9" amino acids 82 to 166 (85 residues), 28.7 bits, see alignment E=7e-10 PF12798: Fer4_3" amino acids 82 to 96 (15 residues), 17.3 bits, see alignment (E = 4.4e-06)

Best Hits

Swiss-Prot: 100% identical to HYFA_ECOLI: Hydrogenase-4 component A (hyfA) from Escherichia coli (strain K12)

KEGG orthology group: K12136, hydrogenase-4 component A [EC: 1.-.-.-] (inferred from 100% identity to eco:b2481)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P23481 at UniProt or InterPro

Protein Sequence (205 amino acids)

>b2481 hydrogenase 4 Fe-S subunit (VIMSS) (Escherichia coli BW25113)
MNRFVVAEPLWCTGCNTCLAACSDVHKTQGLQQHPRLALAKTSTITAPVVCHHCEEAPCL
QVCPVNAISQRDDAIQLNESLCIGCKLCAVVCPFGAISASGSRPVNAHAQYVFQAEGSLK
DGEENAPTQHALLRWEPGVQTVAVKCDLCDFLPEGPACVRACPNQALRLITGDSLQRQMK
EKQRLAASWFANGGEDPLSLTQEQR