Protein Info for b2470 in Escherichia coli BW25113

Name: acrD
Annotation: aminoglycoside/multidrug efflux system (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1037 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 340 to 359 (20 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 393 to 413 (21 residues), see Phobius details amino acids 439 to 460 (22 residues), see Phobius details amino acids 471 to 496 (26 residues), see Phobius details amino acids 538 to 558 (21 residues), see Phobius details amino acids 872 to 890 (19 residues), see Phobius details amino acids 897 to 917 (21 residues), see Phobius details amino acids 923 to 947 (25 residues), see Phobius details amino acids 971 to 990 (20 residues), see Phobius details amino acids 1004 to 1026 (23 residues), see Phobius details TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 1 to 1034 (1034 residues), 1824.7 bits, see alignment E=0 PF00873: ACR_tran" amino acids 1 to 1027 (1027 residues), 1445.3 bits, see alignment E=0 PF03176: MMPL" amino acids 332 to 513 (182 residues), 32.3 bits, see alignment E=8.1e-12 amino acids 873 to 1035 (163 residues), 22.1 bits, see alignment E=1e-08 PF02355: SecD_SecF_C" amino acids 875 to 1018 (144 residues), 20.7 bits, see alignment E=3.7e-08

Best Hits

Swiss-Prot: 100% identical to ACRD_ECOLI: Probable aminoglycoside efflux pump (acrD) from Escherichia coli (strain K12)

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 64% identity to abo:ABO_0964)

MetaCyc: 100% identical to multidrug efflux pump RND permease AcrD (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-360

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P24177 at UniProt or InterPro

Protein Sequence (1037 amino acids)

>b2470 aminoglycoside/multidrug efflux system (NCBI) (Escherichia coli BW25113)
MANFFIDRPIFAWVLAILLCLTGTLAIFSLPVEQYPDLAPPNVRVTANYPGASAQTLENT
VTQVIEQNMTGLDNLMYMSSQSSGTGQASVTLSFKAGTDPDEAVQQVQNQLQSAMRKLPQ
AVQNQGVTVRKTGDTNILTIAFVSTDGSMDKQDIADYVASNIQDPLSRVNGVGDIDAYGS
QYSMRIWLDPAKLNSFQMTAKDVTDAIESQNAQIAVGQLGGTPSVDKQALNATINAQSLL
QTPEQFRDITLRVNQDGSEVRLGDVATVEMGAEKYDYLSRFNGKPASGLGVKLASGANEM
ATAELVLNRLDELAQYFPHGLEYKVAYETTSFVKASIEDVVKTLLEAIALVFLVMYLFLQ
NFRATLIPTIAVPVVLMGTFSVLYAFGYSVNTLTMFAMVLAIGLLVDDAIVVVENVERIM
SEEGLTPREATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGTTGAIYRQFSITIVAAMVL
SVLVAMILTPALCATLLKPLKKGEHHGQKGFFAWFNQMFNRNAERYEKGVAKILHRSLRW
IVIYVLLLGGMVFLFLRLPTSFLPLEDRGMFTTSVQLPSGSTQQQTLKVVEQIEKYYFTH
EKDNIMSVFATVGSGPGGNGQNVARMFIRLKDWSERDSKTGTSFAIIERATKAFNQIKEA
RVIASSPPAISGLGSSAGFDMELQDHAGAGHDALMAARNQLLALAAENPELTRVRHNGLD
DSPQLQIDIDQRKAQALGVAIDDINDTLQTAWGSSYVNDFMDRGRVKKVYVQAAAPYRML
PDDINLWYVRNKDGGMVPFSAFATSRWETGSPRLERYNGYSAVEIVGEAAPGVSTGTAMD
IMESLVKQLPNGFGLEWTAMSYQERLSGAQAPALYAISLLVVFLCLAALYESWSVPFSVM
LVVPLGVIGALLATWMRGLENDVYFQVGLLTVIGLSAKNAILIVEFANEMNQKGHDLFEA
TLHACRQRLRPILMTSLAFIFGVLPMATSTGAGSGGQHAVGTGVMGGMISATILAIYFVP
LFFVLVRRRFPLKPRPE