Protein Info for b2468 in Escherichia coli BW25113

Name: aegA
Annotation: fused predicted oxidoreductase: FeS binding subunit/NAD/FAD-binding subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 PF13247: Fer4_11" amino acids 54 to 145 (92 residues), 37.2 bits, see alignment E=2e-12 PF00037: Fer4" amino acids 80 to 100 (21 residues), 28.1 bits, see alignment (E = 9e-10) PF12837: Fer4_6" amino acids 80 to 100 (21 residues), 27.3 bits, see alignment (E = 1.7e-09) PF12797: Fer4_2" amino acids 82 to 99 (18 residues), 25.3 bits, see alignment (E = 7.4e-09) TIGR01318: glutamate synthase, small subunit" amino acids 187 to 653 (467 residues), 877.9 bits, see alignment E=7e-269 PF14691: Fer4_20" amino acids 205 to 315 (111 residues), 129.5 bits, see alignment E=3.6e-41 PF01494: FAD_binding_3" amino acids 329 to 360 (32 residues), 25.9 bits, see alignment (E = 4.1e-09) PF07992: Pyr_redox_2" amino acids 329 to 640 (312 residues), 83.5 bits, see alignment E=1.2e-26 PF13450: NAD_binding_8" amino acids 332 to 366 (35 residues), 33.9 bits, see alignment (E = 2.3e-11)

Best Hits

Swiss-Prot: 100% identical to AEGA_ECOLI: Protein AegA (aegA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2468)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37127 at UniProt or InterPro

Protein Sequence (659 amino acids)

>b2468 fused predicted oxidoreductase: FeS binding subunit/NAD/FAD-binding subunit (NCBI) (Escherichia coli BW25113)
MNRFIMANSQQCLGCHACEIACVMAHNDEQHVLSQHHFHPRITVIKHQQQRSAVTCHHCE
DAPCARSCPNGAISHVDDSIQVNQQKCIGCKSCVVACPFGTMQIVLTPVAAGKVKATAHK
CDLCAGRENGPACVENCPADALQLVTDVALSGMAKSRRLRTARQEHQPWHASTAAQEMPV
MSKVEQMQATPARGEPDKLAIEARKTGFDEIYLPFRADQAQREASRCLKCGEHSVCEWTC
PLHNHIPQWIELVKAGNIDAAVELSHQTNTLPEITGRVCPQDRLCEGACTIRDEHGAVTI
GNIERYISDQALAKGWRPDLSHVTKVDKRVAIIGAGPAGLACADVLTRNGVGVTVYDRHP
EIGGLLTFGIPSFKLDKSLLARRREIFSAMGIHFELNCEVGKDVSLDSLLEQYDAVFVGV
GTYRSMKAGLPNEDAPGVYDALPFLIANTKQVMGLEELPEEPFINTAGLNVVVLGGGDTA
MDCVRTALRHGASNVTCAYRRDEANMPGSKKEVKNAREEGANFEFNVQPVALELNEQGHV
CGIRFLRTRLGEPDAQGRRRPVPVEGSEFVMPADAVIMAFGFNPHGMPWLESHGVTVDKW
GRIIADVESQYRYQTTNPKIFAGGDAVRGADLVVTAMAEGRHAAQGIIDWLGVKSVKSH