Protein Info for b2458 in Escherichia coli BW25113

Name: eutI
Annotation: predicted phosphotransacetylase subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01515: PTA_PTB
  • amino acids 1 to 320 (320 residues), 418.3 bits, E=1.2e-129
• TIGR00651: phosphate acetyltransferase
  • amino acids 17 to 319 (303 residues), 330.6 bits, E=5.2e-103

Best Hits

Swiss-Prot: 100% identical to EUTD_ECOLI: Ethanolamine utilization protein EutD (eutD) from Escherichia coli (strain K12)

KEGG orthology group: K04020, phosphotransacetylase (inferred from 100% identity to eco:b2458)

MetaCyc: 100% identical to phosphate acetyltransferase EutD (Escherichia coli K-12 substr. MG1655)
Phosphate acetyltransferase. [EC: 2.3.1.8]

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8), ethanolamine utilization-specific" in subsystem Ethanolamine utilization (EC 2.3.1.8)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• mixed acid fermentation (16/16 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (8/9 steps found)
• ethanolamine utilization (5/5 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• sulfoacetaldehyde degradation I (1/2 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (5/9 steps found)
• sulfolactate degradation II (1/4 steps found)
• methanogenesis from acetate (2/6 steps found)
• superpathway of sulfolactate degradation (2/6 steps found)
• superpathway of taurine degradation (2/6 steps found)
• gallate degradation III (anaerobic) (5/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (14/43 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.8

Use Curated BLAST to search for 2.3.1.8

Sequence Analysis Tools

See P77218 at UniProt or InterPro

Protein Sequence (338 amino acids)

>b2458 predicted phosphotransacetylase subunit (NCBI) (Escherichia coli BW25113)
MIIERCRELALRAPARVVFPDALDQRVLKAAQYLHQQGLATPILVANPFELRQFALSHGV
AMDGLQVIDPHGNLAMREEFAHRWLARAGEKTPPDALEKLTDPLMFAAAMVSAGKADVCI
AGNLSSTANVLRAGLRIIGLQPGCKTLSSIFLMLPQYSGPALGFADCSVVPQPTAAQLAD
IALASAETWRAITGEEPRVAMLSFSSNGSARHPCVANVQQATEIVRERAPKLVVDGELQF
DAAFVPEVAAQKAPASPLQGKANVMVFPSLEAGNIGYKIAQRLGGYRAVGPLIQGLAAPM
HDLSRGCSVQEIIELALVAAVPRQTEVNRESSLQTLVE