Protein Info for b2454 in Escherichia coli BW25113

Name: eutJ
Annotation: predicted chaperonin, ethanolamine utilization protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR02529: ethanolamine utilization protein EutJ family protein" amino acids 33 to 267 (235 residues), 373 bits, see alignment E=3e-116 PF11104: PilM_2" amino acids 139 to 244 (106 residues), 28.9 bits, see alignment E=9e-11 PF14450: FtsA" amino acids 141 to 245 (105 residues), 42.1 bits, see alignment E=1.6e-14

Best Hits

Swiss-Prot: 100% identical to EUTJ_ECOLI: Ethanolamine utilization protein EutJ (eutJ) from Escherichia coli (strain K12)

KEGG orthology group: K04024, ethanolamine utilization protein EutJ (inferred from 100% identity to eco:b2454)

Predicted SEED Role

"Ethanolamine utilization protein EutJ" in subsystem Ethanolamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77277 at UniProt or InterPro

Protein Sequence (278 amino acids)

>b2454 predicted chaperonin, ethanolamine utilization protein (NCBI) (Escherichia coli BW25113)
MAHDEQWLTPRLQTAATLCNQTPAATESPLWLGVDLGTCDVVSMVVDRDGQPVAVCLDWA
DVVRDGIVWDFFGAVTIVRRHLDTLEQQFGRRFSHAATSFPPGTDPRISINVLESAGLEV
SHVLDEPTAVADLLQLDNAGVVDIGGGTTGIAIVKKGKVTYSADEATGGHHISLTLAGNR
RISLEEAEQYKRGHGEEIWPAVKPVYEKMADIVARHIEGQGITDLWLAGGSCMQPGVAEL
FRKQFPALQVHLPQHSLFMTPLAIASSGREKAEGLYAK