Protein Info for b2442 in Escherichia coli BW25113

Name: intZ
Annotation: CPZ-55 prophage; predicted integrase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF13356: Arm-DNA-bind_3" amino acids 6 to 93 (88 residues), 79.9 bits, see alignment E=1.9e-26 PF00589: Phage_integrase" amino acids 214 to 372 (159 residues), 74.1 bits, see alignment E=1.9e-24

Best Hits

Swiss-Prot: 100% identical to INTZ_ECOLI: Prophage integrase IntZ (intZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2442)

Predicted SEED Role

"putative prophage integrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76542 at UniProt or InterPro

Protein Sequence (402 amino acids)

>b2442 CPZ-55 prophage; predicted integrase (RefSeq) (Escherichia coli BW25113)
MSKTPLTAKAIDAAQPQDKPYKLTDSLTPGLFLLVHPNGSKYWRFRYWLNKREFLQAIGV
YPLITLKEARRRATESRSLIANGINPVEQARKEKAIDALNMAAGFKKVAEDWFATRVGGW
SESYAKQVRSALEKDVYPVLGKRSIVDITARDVLALLQKKERTAPEQARKLRRRIGEIFK
FAVITELVTRNPVADLDTALKARRPGHNAWIPISEIPAFYKALERAGSVQIQTAIRLLIL
TALRTAELRLCRWEWINLEDATITLPAEVMKARRPHVVPLSRQAVELLQDQFTRSGYSAF
VFPGRFMDKPLSASAILKALERIGYKSIATGHGWRTTFSTALNESGRYSPDWIEIQLAHV
PKGIRGVYNQAAYLKQRRAMMQDYADAIDSILAGNGNPLEPE