Protein Info for b2439 in Escherichia coli BW25113

Name: eutL
Annotation: predicted carboxysome structural protein with predicted role in ethanolamine utilization (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 TIGR04502: microcompartment protein EutL" amino acids 6 to 217 (212 residues), 334.2 bits, see alignment E=1.5e-104 PF00936: BMC" amino acids 36 to 108 (73 residues), 33.7 bits, see alignment E=1.4e-12 amino acids 162 to 208 (47 residues), 25.1 bits, see alignment 6.8e-10

Best Hits

Swiss-Prot: 100% identical to EUTL_ECOLI: Ethanolamine utilization protein EutL (eutL) from Escherichia coli (strain K12)

KEGG orthology group: K04026, ethanolamine utilization protein EutL (inferred from 100% identity to eco:b2439)

Predicted SEED Role

"Ethanolamine utilization polyhedral-body-like protein EutL" in subsystem Ethanolamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76541 at UniProt or InterPro

Protein Sequence (219 amino acids)

>b2439 predicted carboxysome structural protein with predicted role in ethanolamine utilization (NCBI) (Escherichia coli BW25113)
MPALDLIRPSVTAMRVIASVNADFARELKLPPHIRSLGLISADSDDVTYIAADEATKQAM
VEVVYGRSLYAGAAHGPSPTAGEVLIMLGGPNPAEVRAGLDAMIAHIENGAAFQWANDAQ
DTAFLAHVVSRTGSYLSSTAGITLGDPMAYLVAPPLEATYGIDAALKSADVQLATYVPPP
SETNYSAAFLTGSQAACKAACNAFTDAVLEIARNPIQRA