Protein Info for b2428 in Escherichia coli BW25113

Name: yfeU
Annotation: N-acetylmuramic acid-6-phosphate etherase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 TIGR00274: N-acetylmuramic acid 6-phosphate etherase" amino acids 6 to 296 (291 residues), 515.2 bits, see alignment E=2.1e-159 PF13580: SIS_2" amino acids 46 to 165 (120 residues), 27.3 bits, see alignment E=5e-10 PF01380: SIS" amino acids 128 to 208 (81 residues), 33.2 bits, see alignment E=6.2e-12 PF20741: GKRP-like_C" amino acids 222 to 258 (37 residues), 28.9 bits, see alignment 2.1e-10

Best Hits

Swiss-Prot: 100% identical to MURQ_ECOLC: N-acetylmuramic acid 6-phosphate etherase (murQ) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K07106, N-acetylmuramic acid 6-phosphate etherase [EC: 4.2.-.-] (inferred from 100% identity to eco:b2428)

MetaCyc: 100% identical to N-acetylmuramic acid 6-phosphate etherase (Escherichia coli K-12 substr. MG1655)
RXN0-4641 [EC: 4.2.1.126]

Predicted SEED Role

"N-acetylmuramic acid 6-phosphate etherase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.-.- or 4.2.1.126

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76535 at UniProt or InterPro

Protein Sequence (298 amino acids)

>b2428 N-acetylmuramic acid-6-phosphate etherase (NCBI) (Escherichia coli BW25113)
MQFEKMITEGSNTASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPDIAAAIDVIHAQVS
GGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQHAVEGAEDSREGG
VNDLKNINLTAQDVVVGIAASGRTPYVIAGLEYARQLGCRTVGISCNPGSAVSTTAEFAI
TPIVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVDVVATNEKLHVRQVN
IVKNATGCSAEQAEAALIACERNCKTAIVMVLKNLDAAEAKKRLDQHGGFIRQVLDKE