Protein Info for b2393 in Escherichia coli BW25113

Name: nupC
Annotation: nucleoside (except guanosine) transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 244 to 271 (28 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 381 to 399 (19 residues), see Phobius details TIGR00804: nucleoside transporter, NupC family" amino acids 5 to 398 (394 residues), 486.7 bits, see alignment E=3e-150 PF01773: Nucleos_tra2_N" amino acids 10 to 82 (73 residues), 74.5 bits, see alignment E=1.2e-24 PF07670: Gate" amino acids 91 to 191 (101 residues), 56.7 bits, see alignment E=4.4e-19 PF07662: Nucleos_tra2_C" amino acids 193 to 396 (204 residues), 210.8 bits, see alignment E=3.1e-66

Best Hits

Swiss-Prot: 100% identical to NUPC_ECOLI: Nucleoside permease NupC (nupC) from Escherichia coli (strain K12)

KEGG orthology group: K11535, nucleoside transport protein (inferred from 100% identity to eco:b2393)

MetaCyc: 100% identical to nucleoside:H+ symporter NupC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-108A; TRANS-RXN-108B; TRANS-RXN-108C; TRANS-RXN-108D; TRANS-RXN-108E; TRANS-RXN-108F; TRANS-RXN-108G; TRANS-RXN-108H; TRANS-RXN-108I; TRANS-RXN-476

Predicted SEED Role

"Nucleoside permease NupC" in subsystem Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFF2 at UniProt or InterPro

Protein Sequence (400 amino acids)

>b2393 nucleoside (except guanosine) transporter (NCBI) (Escherichia coli BW25113)
MDRVLHFVLALAVVAILALLVSSDRKKIRIRYVIQLLVIEVLLAWFFLNSDVGLGFVKGF
SEMFEKLLGFANEGTNFVFGSMNDQGLAFFFLKVLCPIVFISALIGILQHIRVLPVIIRA
IGFLLSKVNGMGKLESFNAVSSLILGQSENFIAYKDILGKISRNRMYTMAATAMSTVSMS
IVGAYMTMLEPKYVVAALVLNMFSTFIVLSLINPYRVDASEENIQMSNLHEGQSFFEMLG
EYILAGFKVAIIVAAMLIGFIALIAALNALFATVTGWFGYSISFQGILGYIFYPIAWVMG
VPSSEALQVGSIMATKLVSNEFVAMMDLQKIASTLSPRAEGIISVFLVSFANFSSIGIIA
GAVKGLNEEQGNVVSRFGLKLVYGSTLVSVLSASIAALVL