Protein Info for b2389 in Escherichia coli BW25113

Name: yfeO
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details amino acids 324 to 340 (17 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 370 to 399 (30 residues), see Phobius details PF00654: Voltage_CLC" amino acids 86 to 392 (307 residues), 72.7 bits, see alignment E=1.7e-24

Best Hits

Swiss-Prot: 100% identical to YFEO_ECO57: Putative ion-transport protein YfeO (yfeO) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b2389)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P67729 at UniProt or InterPro

Protein Sequence (418 amino acids)

>b2389 hypothetical protein (NCBI) (Escherichia coli BW25113)
MLHPRARTMLLLSLPAVAIGIASSLILIVVMKIASVLQNLLWQRLPGTLGIAQDSPLWII
GVLTLTGIAVGLVIRFSQGHAGPDPACEPLIGAPVPPSALPGLIVALILGLAGGVSLGPE
HPIMTVNIALAVAIGARLLPRVNRMEWTILASAGTIGALFGTPVAAALIFSQTLNGSSEV
PLWDRLFAPLMAAAAGALTTGLFFHPHFSLPIAHYGQMEMTDILSGAIVAAIAIAAGMVA
VWCLPRLHAMMHQMKNPVLVLGIGGFILGILGVIGGPVSLFKGLDEMQQMVANQAFSTSD
YFLLAVIKLAALVVAAASGFRGGRIFPAVFVGVALGLMLHEHVPAVPAAITVSCAILGIV
LVVTRDGWLSLFMAAVVVPNTTLLPLLCIVMLPAWLLLAGKPMMMVNRPKQQPPHDNV