Protein Info for b2378 in Escherichia coli BW25113

Name: ddg
Annotation: putative heat shock protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03279: Lip_A_acyltrans
  • amino acids 5 to 296 (292 residues), 406.7 bits, E=2.9e-126
• TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase
  • amino acids 5 to 305 (301 residues), 474 bits, E=1e-146

Best Hits

Swiss-Prot: 100% identical to LPXP_ECOLI: Lipid A biosynthesis palmitoleoyltransferase (lpxP) from Escherichia coli (strain K12)

KEGG orthology group: K12974, palmitoleoyl transferase [EC: 2.3.1.-] (inferred from 100% identity to eco:b2378)

MetaCyc: 100% identical to palmitoleoyl acyltransferase (Escherichia coli K-12 substr. MG1655)
PALMITOTRANS-RXN [EC: 2.3.1.242]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of (Kdo)₂-lipid A biosynthesis (17/17 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.242

Sequence Analysis Tools

See P0ACV2 at UniProt or InterPro

Protein Sequence (306 amino acids)

>b2378 putative heat shock protein (VIMSS) (Escherichia coli BW25113)
MFPQCKFSREFLHPRYWLTWFGLGVLWLWVQLPYPVLCFLGTRIGAMARPFLKRRESIAR
KNLELCFPQHSAEEREKMIAENFRSLGMALVETGMAWFWPDSRVRKWFDVEGLDNLKRAQ
MQNRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNQLMEWVQTRGRMRSNKAMIGRN
NLRGIVGALKKGEAVWFAPDQDYGRKGSSFAPFFAVENVATTNGTYVLSRLSGAAMLTVT
MVRKADYSGYRLFITPEMEGYPTDENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPVG
ESSLYI