Protein Info for b2372 in Escherichia coli BW25113

Name: yfdV
Annotation: predicted transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details PF03547: Mem_trans" amino acids 5 to 307 (303 residues), 267.1 bits, see alignment E=8.3e-84

Best Hits

Swiss-Prot: 100% identical to YFDV_ECO57: Uncharacterized transporter YfdV (yfdV) from Escherichia coli O157:H7

KEGG orthology group: K07088, (no description) (inferred from 100% identity to eco:b2372)

Predicted SEED Role

"putative receptor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AA49 at UniProt or InterPro

Protein Sequence (314 amino acids)

>b2372 predicted transporter (NCBI) (Escherichia coli BW25113)
MLTFFIGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREM
IFADTRLTLVSLVVIVGCFFFSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPI
YGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKKNSNLSALISAAKEPVVWAPV
LATILVLVGVKIPAAWDPTFNLIAKANSGVAVFAAGLTLAAHKFEFSAEIAYNTFLKLIL
MPLALLLVGMACHLNSEHLQMMVLAGALPPAFSGIIIASRFNVYTRTGTASLAVSVLGFV
VTAPLWIYVSRLVS