Protein Info for b2365 in Escherichia coli BW25113

Name: dsdX
Annotation: predicted transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 99 to 129 (31 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 258 to 282 (25 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 343 to 371 (29 residues), see Phobius details amino acids 385 to 408 (24 residues), see Phobius details amino acids 420 to 444 (25 residues), see Phobius details TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 5 to 445 (441 residues), 585.5 bits, see alignment E=3.8e-180 PF02447: GntP_permease" amino acids 7 to 444 (438 residues), 555.5 bits, see alignment E=4e-171

Best Hits

Swiss-Prot: 100% identical to DSDX_ECOLI: D-serine transporter DsdX (dsdX) from Escherichia coli (strain K12)

KEGG orthology group: K13629, D-serine transporter (inferred from 100% identity to eco:b2365)

Predicted SEED Role

"D-serine permease DsdX" in subsystem Glycine and Serine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P08555 at UniProt or InterPro

Protein Sequence (445 amino acids)

>b2365 predicted transporter (NCBI) (Escherichia coli BW25113)
MHSQIWVVSTLLISIVLIVLTIVKFKFHPFLALLLASFFVGTMMGMGPLDMVNAIESGIG
GTLGFLAAVIGLGTILGKMMEVSGAAERIGLTLQRCRWLSVDVIMVLVGLICGITLFVEV
GVVLLIPLAFSIAKKTNTSLLKLAIPLCTALMAVHCVVPPHPAALYVANKLGADIGSVIV
YGLLVGLMASLIGGPLFLKFLGQRLPFKPVPTEFADLKVRDEKTLPSLGATLFTILLPIA
LMLVKTIAELNMARESGLYILVEFIGNPITAMFIAVFVAYYVLGIRQHMSMGTMLTHTEN
GFGSIANILLIIGAGGAFNAILKSSSLADTLAVILSNMHMHPILLAWLVALILHAAVGSA
TVAMMGATAIVAPMLPLYPDISPEIIAIAIGSGAIGCTIVTDSLFWLVKQYCGATLNETF
KYYTTATFIASVVALAGTFLLSFII