Protein Info for b2352 in Escherichia coli BW25113

Name: yfdI
Annotation: CPS-53 (KpLE1) prophage; predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 170 to 199 (30 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details amino acids 380 to 398 (19 residues), see Phobius details amino acids 410 to 432 (23 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to YFDI_ECOLI: Uncharacterized protein YfdI (yfdI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2352)

MetaCyc: 100% identical to CPS-53 (KpLE1) prophage; serotype-specific glucosyl transferase YfdI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"putative ligase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76507 at UniProt or InterPro

Protein Sequence (443 amino acids)

>b2352 CPS-53 (KpLE1) prophage; predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MNKAIKVSLYISFVLIICALSKNIMMLNTSDFGRAIKPLIEDIPAFTYDLPLLYKLKGHI
DSIDSYEYISSYSYILYTYVLFISIFTEYLDARVLSLFLKVIYIYSLYAIFTSYIKTERY
VTLFTFFILAFLMCSSSTLSMFASFYQEQIVIIFLPFLVYSLTCKNNKSMLLLFFSLLII
STAKNQFILTPLIVYSYYIFFDRHKLIIKSVICVVCLLASIFAISYSKGVVELNKYHATY
FGSYLYMKNNGYKMPSYVDDKCVGLDAWGNKFDISFGATPTEVGTECFESHKDETFSNAL
FLLVSKPSTIFKLPFDDGVMSQYKENYFHVYKKLHVIYGESNILTTITNIKDNIFKNIRF
ISLLLFFIASIFIRNNKIKASLFVVSLFGISQFYVSFFGEGYRDLSKHLFGMYFSFDLCL
YITVVFLIYKIIQRNQDNSDVKH