Protein Info for b2350 in Escherichia coli BW25113

Name: yfdG
Annotation: CPS-53 (KpLE1) prophage; bactoprenol-linked glucose translocase (flippase) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to GTRA_ECOLI: Prophage bactoprenol-linked glucose translocase homolog (yfdG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2350)

Predicted SEED Role

"Bactoprenol-linked glucose translocase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77682 at UniProt or InterPro

Protein Sequence (120 amino acids)

>b2350 CPS-53 (KpLE1) prophage; bactoprenol-linked glucose translocase (flippase) (NCBI) (Escherichia coli BW25113)
MLKLFAKYTSIGVLNTLIHWVVFGVCIYVAHTNQALANFAGFVVAVSFSFFANAKFTFKA
STTTMRYMLYVGFMGTLSATVGWAADRCALPPMITLVTFSAISLVCGFVYSKFIVFRDAK