Protein Info for b2344 in Escherichia coli BW25113

Name: fadL
Annotation: long-chain fatty acid outer membrane transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03349: Toluene_X" amino acids 16 to 446 (431 residues), 560 bits, see alignment E=1.3e-172

Best Hits

Swiss-Prot: 100% identical to FADL_ECOLI: Long-chain fatty acid transport protein (fadL) from Escherichia coli (strain K12)

KEGG orthology group: K06076, long-chain fatty acid transport protein (inferred from 100% identity to eco:b2344)

MetaCyc: 100% identical to long-chain fatty acid outer membrane channel / bacteriophage T2 receptor (Escherichia coli K-12 substr. MG1655)
RXN0-1802

Predicted SEED Role

"Long-chain fatty acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P10384 at UniProt or InterPro

Protein Sequence (446 amino acids)

>b2344 long-chain fatty acid outer membrane transporter (RefSeq) (Escherichia coli BW25113)
MSQKTLFTKSALAVAVALISTQAWSAGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPA
LITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWG
ASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKI
ERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILY
ELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMW
EVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYY
DDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSV
KINEGPYQFESEGKAWLFGTNFNYAF