Protein Info for b2335 in Escherichia coli BW25113

Name: yfcR
Annotation: predicted fimbrial-like adhesin protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00419: Fimbrial" amino acids 41 to 170 (130 residues), 69.9 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 100% identical to YFCR_ECOLI: Uncharacterized fimbrial-like protein YfcR (yfcR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2335)

Predicted SEED Role

"Minor fimbrial subunit StfE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76501 at UniProt or InterPro

Protein Sequence (170 amino acids)

>b2335 predicted fimbrial-like adhesin protein (NCBI) (Escherichia coli BW25113)
MTGGVMSQKFVVGAGLLVCSVCSLSAMAGSKPVDLILRVLVDAPPPCSIKGSQVEFGNMI
ADNVDGTNYRQDAKYTLNCTNSLANDLRMQLKGNTSTINGETVLSTNITGLGIRIENSAD
NSLFAVGENSWTPFNINNQPQLKAVPVKASGAQLAAGEFNASLTMVVDYQ