Protein Info for b2299 in Escherichia coli BW25113
Name: yfcD
Annotation: predicted NUDIX hydrolase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to YFCD_ECO57: Uncharacterized Nudix hydrolase YfcD (yfcD) from Escherichia coli O157:H7
KEGG orthology group: K01554, [EC: 3.6.-.-] (inferred from 100% identity to eco:b2299)Predicted SEED Role
"Putative Nudix hydrolase YfcD (EC 3.6.-.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.-.-)
Isozymes
Compare fitness of predicted isozymes for: 3.6.-.-
Use Curated BLAST to search for 3.6.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P65556 at UniProt or InterPro
Protein Sequence (180 amino acids)
>b2299 predicted NUDIX hydrolase (NCBI) (Escherichia coli BW25113) MEQRRLASTEWVDIVNEENEVIAQASREQMRAQCLRHRATYIVVHDGMGKILVQRRTETK DFLPGMLDATAGGVVQADEQLLESARREAEEELGIAGVPFAEHGQFYFEDKNCRVWGALF SCVSHGPFALQEDEVSEVCWLTPEEITARCDEFTPDSLKALALWMKRNAKNEAVETETAE