Protein Info for b2299 in Escherichia coli BW25113

Name: yfcD
Annotation: predicted NUDIX hydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF00293: NUDIX" amino acids 36 to 156 (121 residues), 71.5 bits, see alignment E=3.6e-24

Best Hits

Swiss-Prot: 100% identical to YFCD_ECO57: Uncharacterized Nudix hydrolase YfcD (yfcD) from Escherichia coli O157:H7

KEGG orthology group: K01554, [EC: 3.6.-.-] (inferred from 100% identity to eco:b2299)

Predicted SEED Role

"Putative Nudix hydrolase YfcD (EC 3.6.-.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.-.-

Use Curated BLAST to search for 3.6.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P65556 at UniProt or InterPro

Protein Sequence (180 amino acids)

>b2299 predicted NUDIX hydrolase (NCBI) (Escherichia coli BW25113)
MEQRRLASTEWVDIVNEENEVIAQASREQMRAQCLRHRATYIVVHDGMGKILVQRRTETK
DFLPGMLDATAGGVVQADEQLLESARREAEEELGIAGVPFAEHGQFYFEDKNCRVWGALF
SCVSHGPFALQEDEVSEVCWLTPEEITARCDEFTPDSLKALALWMKRNAKNEAVETETAE