Protein Info for b2298 in Escherichia coli BW25113

Name: yfcC
Annotation: putative S-transferase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 172 to 198 (27 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 392 to 417 (26 residues), see Phobius details amino acids 424 to 424 (1 residues), see Phobius details amino acids 427 to 440 (14 residues), see Phobius details amino acids 453 to 471 (19 residues), see Phobius details amino acids 482 to 503 (22 residues), see Phobius details PF03606: DcuC" amino acids 15 to 501 (487 residues), 537.4 bits, see alignment E=1.3e-165

Best Hits

Swiss-Prot: 100% identical to YFCC_ECOLI: Putative basic amino acid antiporter YfcC (yfcC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2298)

Predicted SEED Role

"Putative S-transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39263 at UniProt or InterPro

Protein Sequence (506 amino acids)

>b2298 putative S-transferase (VIMSS) (Escherichia coli BW25113)
MSAITESKPTRRWAMPDTLVIIFFVAILTSLATWVVPVGMFDSQEVQYQVDGQTKTRKVV
DPHSFRILTNEAGEPEYHRVQLFTTGDERPGLMNFPFEGLTSGSKYGTAVGIIMFMLVIG
GAFGIVMRTGTIDNGILALIRHTRGNEILFIPALFILFSLGGAVFGMGEEAVAFAIIIAP
LMVRLGYDSITTVLVTYIATQIGFASSWMNPFCVVVAQGIAGVPVLSGSGLRIVVWVIAT
LIGLIFTMVYASRVKKNPLLSRVHESDRFFREKQADVEQRPFTFGDWLVLIVLTAVMVWV
IWGVIVNAWFIPEIASQFFTMGLVIGIIGVVFRLNGMTVNTMASSFTEGARMMIAPALLV
GFAKGILLLVGNGEAGDASVLNTILNSIANAISGLDNAVAAWFMLLFQAVFNFFVTSGSG
QAALTMPLLAPLGDLVGVNRQVTVLAFQFGDGFSHIIYPTSASLMATLGVCRVDFRNWLK
VGATLLGLLFIMSSVVVIGAQLMGYH