Protein Info for b2292 in Escherichia coli BW25113

Name: yfbS
Annotation: predicted transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 21 (15 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 57 to 83 (27 residues), see Phobius details amino acids 95 to 124 (30 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 418 to 434 (17 residues), see Phobius details amino acids 437 to 453 (17 residues), see Phobius details amino acids 467 to 487 (21 residues), see Phobius details amino acids 507 to 537 (31 residues), see Phobius details amino acids 548 to 568 (21 residues), see Phobius details amino acids 588 to 608 (21 residues), see Phobius details PF03600: CitMHS" amino acids 16 to 544 (529 residues), 281.7 bits, see alignment E=1.7e-87 amino acids 496 to 607 (112 residues), 55 bits, see alignment E=1.4e-18 PF02080: TrkA_C" amino acids 232 to 297 (66 residues), 35.7 bits, see alignment E=1.3e-12 amino acids 326 to 394 (69 residues), 43 bits, see alignment E=7.1e-15 PF06808: DctM" amino acids 413 to 604 (192 residues), 31.5 bits, see alignment E=1.7e-11 PF00939: Na_sulph_symp" amino acids 437 to 604 (168 residues), 43.8 bits, see alignment E=3.9e-15

Best Hits

Swiss-Prot: 100% identical to YFBS_ECO57: Uncharacterized transporter YfbS (yfbS) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b2292)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFU2 at UniProt or InterPro

Protein Sequence (610 amino acids)

>b2292 predicted transporter (NCBI) (Escherichia coli BW25113)
MNGELIWVLSLLAVAIVLFATGRVRMDAVALFVIVAFALSGTLTVPEVFSGFSDPNVVLI
AALFIIGDGLVRTGVATVMGTWLVKVAGNSEIKMLVLLMLTVAGLGAFMSSTGVVAIFIP
VVLSVAMRMQTSPSRLMMPLSFAGLISGMMTLVATPPNLVVNSELLREGYHGFSFFSVTP
IGLVVLVLGILYMLVMRFMLKGDTQTPQREGWTRRTFRDLIREYRLTGRARRLAIRPGSP
MIGQRLDDLKLRERYGANVIGVERWRRFRRVIVNVNGVSEFRARDVLLIDMSAADVDLRQ
FCSEQLLEPMVLRGEYFSDQALDVGMAEISLIPESELIGKSVREIGFRTRYGLNVVGLKR
NGVALEGSLADEPLLLGDIILVVGNWKLIGMLAKQGRDFVALNLPEEVSEASPAHSQAPH
AIFCLVLMVALMLTDEIPNPVAAIIACLLMGKFRCIDAESAYKSIHWPSIILIVGMMPFA
VALQKTGGVALAVKGLMDIGGGYGPHMMLGCLFVLSAVIGLFISNTATAVLMAPIALAAA
KTMGVSPYPFAMVVAMAASAAFMTPVSSPVNTLVLGPGNYSFSDFVKLGVPFTIIVMAVC
VVMIPMLFPF