Protein Info for b2291 in Escherichia coli BW25113

Name: yfbR
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12917: YfbR-like
  • amino acids 5 to 186 (182 residues), 258.1 bits, E=6.6e-81
• PF13023: HD_3
  • amino acids 11 to 157 (147 residues), 61.1 bits, E=1.9e-20
• PF01966: HD
  • amino acids 30 to 141 (112 residues), 40.6 bits, E=4.4e-14

Best Hits

Swiss-Prot: 100% identical to 5DNU_ECOBW: 5'-deoxynucleotidase YfbR (yfbR) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K08722, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 100% identity to eco:b2291)

MetaCyc: 100% identical to dCMP phosphohydrolase (Escherichia coli K-12 substr. MG1655)
RXN-14143 [EC: 3.1.3.89]; 3.1.3.89 [EC: 3.1.3.89]; 3.1.3.89 [EC: 3.1.3.89]; 3.1.3.89 [EC: 3.1.3.89]

Predicted SEED Role

"Nucleotidase YfbR, HD superfamily"

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• adenosine nucleotides degradation II (5/5 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (3/3 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• superpathway of purines degradation in plants (13/18 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• ureide biosynthesis (5/7 steps found)
• NAD salvage (plants) (5/11 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.1.3.89

Sequence Analysis Tools

See P76491 at UniProt or InterPro

Protein Sequence (199 amino acids)

>b2291 hypothetical protein (NCBI) (Escherichia coli BW25113)
MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
IFVPSFHLSLDEISQDSPL