Protein Info for b2287 in Escherichia coli BW25113

Name: nuoB
Annotation: NADH dehydrogenase subunit B (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to NUOB_SHIB3: NADH-quinone oxidoreductase subunit B (nuoB) from Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 100% identity to eco:b2287)

MetaCyc: 100% identical to NADH:quinone oxidoreductase subunit B (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
NAD(P)/NADPH interconversion (4/6 steps found)
NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
aerobic respiration I (cytochrome c) (2/4 steps found)
Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFC7 at UniProt or InterPro

Protein Sequence (220 amino acids)

>b2287 NADH dehydrogenase subunit B (NCBI) (Escherichia coli BW25113)
MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFG
LSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEP
KWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKER
RPLSWVVGDQGVYRANMQSERERKRGERIAVTNLRTPDEI