Protein Info for b2282 in Escherichia coli BW25113

Name: nuoH
Annotation: NADH dehydrogenase subunit H (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00146: NADHdh
  • amino acids 17 to 317 (301 residues), 400.4 bits, E=2.6e-124

Best Hits

Swiss-Prot: 100% identical to NUOH_ECO27: NADH-quinone oxidoreductase subunit H (nuoH) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 100% identity to eco:b2282)

MetaCyc: 100% identical to NADH:quinone oxidoreductase subunit H (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NADH to dimethyl sulfoxide electron transfer (2/2 steps found)
• NADH to fumarate electron transfer (2/2 steps found)
• NADH to hydrogen peroxide electron transfer (2/2 steps found)
• NADH to trimethylamine N-oxide electron transfer (2/2 steps found)
• nitrate reduction VIII (dissimilatory) (2/2 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NAD(P)/NADPH interconversion (4/6 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

See P0AFD4 at UniProt or InterPro

Protein Sequence (325 amino acids)

>b2282 NADH dehydrogenase subunit H (NCBI) (Escherichia coli BW25113)
MSWISPELIEILLTILKAVVILLVVVTCGAFMSFGERRLLGLFQNRYGPNRVGWGGSLQL
VADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSPGWVVADLNIGILFFL
MMAGLAVYAVLFAGWSSNNKYSLLGAMRASAQTLSYEVFLGLSLMGVVAQAGSFNMTDIV
NSQAHVWNVIPQFFGFITFAIAGVAVCHRHPFDQPEAEQELADGYHIEYSGMKFGLFFVG
EYIGIVTISALMVTLFFGGWQGPLLPPFIWFALKTAFFMMMFILIRASLPRPRYDQVMSF
GWKICLPLTLINLLVTAAVILWQAQ