Protein Info for b2269 in Escherichia coli BW25113

Name: elaD
Annotation: predicted enzyme (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF22103: ElaD_SseL-like_N" amino acids 30 to 138 (109 residues), 172.2 bits, see alignment E=4.5e-55 PF22102: ElaD-SseL-like_C" amino acids 158 to 359 (202 residues), 89.6 bits, see alignment E=3.5e-29 PF02902: Peptidase_C48" amino acids 165 to 362 (198 residues), 112.2 bits, see alignment E=5e-36

Best Hits

Swiss-Prot: 100% identical to ELAD_ECOLI: Protease ElaD (elaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2269)

MetaCyc: 100% identical to protease ElaD (Escherichia coli K-12 substr. MG1655)
Ubiquitinyl hydrolase 1. [EC: 3.4.19.12]

Predicted SEED Role

"ElaD protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.19.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q47013 at UniProt or InterPro

Protein Sequence (403 amino acids)

>b2269 predicted enzyme (NCBI) (Escherichia coli BW25113)
MMVTVVSNYCQLSQTQLSQTFAEKFTVTEELLQSLKKTALSGDEESIELLHNIALGYDKF
GKEAEDILYHIVRTPTNETLSIIRLIKNACLKLYNLAHIATNSPLKSHDSDDLLFKKLFS
PSKLMTIIGDEIPLISEKQSLSKVLLNDENNELSDGTNFWDKNRQLTTDEIACYLQKIAA
NAKNTQVNYPTGLYVPYSTRTHLEDALNENIKSDPSWPNEVQLFPINTGGHWILVSLQKI
VNKKNNKLQIKCVIFNSLRALGYDKENSLKRVINSFNSELMGEMSNNNIKVHLNEPEIIF
LHADLQQYLSQSCGAFVCMAAQEVIEQRESNSDSAPYTLLKNHADRFKKYSAEEQYEIDF
QHRLANRNCYLDKYGDANINHYYRNLEIKHSQPKNRASGKRVS