Protein Info for b2267 in Escherichia coli BW25113

Name: elaA
Annotation: predicted acyltransferase with acyl-CoA N-acyltransferase domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF00583: Acetyltransf_1" amino acids 22 to 129 (108 residues), 40.3 bits, see alignment E=5.2e-14 PF13673: Acetyltransf_10" amino acids 42 to 149 (108 residues), 57 bits, see alignment E=3.2e-19 PF13508: Acetyltransf_7" amino acids 50 to 130 (81 residues), 36.3 bits, see alignment E=9.2e-13

Best Hits

Swiss-Prot: 100% identical to ELAA_SHIFL: Protein ElaA (elaA) from Shigella flexneri

KEGG orthology group: K02348, ElaA protein (inferred from 100% identity to eco:b2267)

Predicted SEED Role

"ElaA protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AEH3 at UniProt or InterPro

Protein Sequence (153 amino acids)

>b2267 predicted acyltransferase with acyl-CoA N-acyltransferase domain (NCBI) (Escherichia coli BW25113)
MIEWQDLHHSELSVSQLYALLQLRCAVFVVEQNCPYQDIDGDDLTGDNRHILGWKNDELV
AYARILKSDDDLEPVVIGRVIVSEALRGEKVGQQLMSKTLETCTHHWPDKPVYLGAQAHL
QNFYQSFGFIPVTEVYEEDGIPHIGMAREVIQA