Protein Info for b2258 in Escherichia coli BW25113
Name: b2258
Annotation: putative transport/receptor protein (VIMSS)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ARNF_ECOLI: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF) from Escherichia coli (strain K12)
KEGG orthology group: K12963, undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF (inferred from 100% identity to eco:b2258)MetaCyc: 100% identical to undecaprenyl-phosphate-alpha-L-Ara4N flippase - ArnF subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-276
Predicted SEED Role
"Polymyxin resistance protein PmrM" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P76474 at UniProt or InterPro
Protein Sequence (128 amino acids)
>b2258 putative transport/receptor protein (VIMSS) (Escherichia coli BW25113) MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF LPTTKQRY