Protein Info for b2253 in Escherichia coli BW25113

Name: arnB
Annotation: uridine 5'-(beta-1-threo-pentapyranosyl-4-ulose diphosphate) aminotransferase, PLP-dependent (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF01041: DegT_DnrJ_EryC1" amino acids 12 to 374 (363 residues), 465.9 bits, see alignment E=2.1e-143 PF01053: Cys_Met_Meta_PP" amino acids 32 to 206 (175 residues), 34.6 bits, see alignment E=1.7e-12 PF00155: Aminotran_1_2" amino acids 35 to 163 (129 residues), 36.4 bits, see alignment E=7.1e-13 PF00266: Aminotran_5" amino acids 44 to 279 (236 residues), 25.7 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 100% identical to ARNB_ECOHS: UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (arnB) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K07806, UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC: 2.6.1.87] (inferred from 100% identity to eco:b2253)

MetaCyc: 100% identical to UDP-4-amino-4-deoxy-L-arabinose aminotransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1863 [EC: 2.6.1.87, 2.6.1.92]

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.- or 2.6.1.87 or 2.6.1.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77690 at UniProt or InterPro

Protein Sequence (379 amino acids)

>b2253 uridine 5'-(beta-1-threo-pentapyranosyl-4-ulose diphosphate) aminotransferase, PLP-dependent (RefSeq) (Escherichia coli BW25113)
MSEFLPFSRPAMGVEELAAVKEVLESGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAG
MHITLMALKIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAITP
RTKAIIPVHYAGAPADIDAIRAIGERYGIAVIEDAAHAVGTYYKGRHIGAKGTAIFSFHA
IKNITCAEGGLIVTDNENLARQLRMLKFHGLGVDAYDRQTWGRAPQAEVLTPGYKYNLTD
INAAIALTQLVKLEHLNTRRREIAQQYQQALAALPFQPLSLPAWPHVHAWHLFIIRVDEQ
RCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPTLSLPNTEWNSERICSLPLFPD
MTTADADHVITALQQLAGQ