Protein Info for b2230 in Escherichia coli BW25113

Name: yfaA
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF09909: DUF2138" amino acids 15 to 559 (545 residues), 872.6 bits, see alignment E=5.1e-267

Best Hits

Swiss-Prot: 100% identical to YFAA_ECOLI: Uncharacterized protein YfaA (yfaA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2230)

Predicted SEED Role

"FIG00638699: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P17994 at UniProt or InterPro

Protein Sequence (562 amino acids)

>b2230 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MSGEKKAKGWRFYGLVGFGAIALLSAGVWALQYAGSGPEKTLSPLVVHNNLQIDLNEPDL
FLDSDSLSQLPKDLLTIPFLHDVLSEDFVFYYQNHADRLGIEGSIRRIVYEHDLTLKDKL
FSSLLDQPAQAALWHDKQGHLSHYMVLIQRSGLSKLLEPLLFAATSDSQLSKTEISSIKI
NSETVPVYQLRYNGNNALMFATYQDKMLVFSSTDMLFKDDQQDTEATAIAGDLLSGKKRW
QASFGLEERTAEKTPVRQRIVVSARWLGFGYQRLMPSFAGVRFEMGNDGWHSFVALNDES
ASVDASFDFTPVWNSMPAGASFCVAVPYSHGIAEEMLSHISQENDKLNGALDGAAGLCWY
EDSKLQTPLFVGQFDGTAEQAQLPGKLFTQNIGAHESKAPEGVLPVSQTQQGEAQIWRRE
VSSRYGQYPKAQAAQPDQLMSDYFFRVSLAMQNKTLLFSLDDTLVNNALQTLNKTRPAMV
DVIPTDGIVPLYINPQGIAKLLRNETLTSLPKNLEPVFYNAAQTLLMPKLDALSQQPRYV
MKLAQMEPGAAWQWLPITWQPL