Protein Info for b2226 in Escherichia coli BW25113

Name: yfaQ
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF10062: DUF2300" amino acids 84 to 205 (122 residues), 146.4 bits, see alignment E=5e-47 amino acids 412 to 532 (121 residues), 157.9 bits, see alignment E=1.4e-50 PF08486: SpoIID" amino acids 312 to 374 (63 residues), 26.1 bits, see alignment E=1.1e-09

Best Hits

Swiss-Prot: 100% identical to YFAQ_ECOLI: Uncharacterized protein YfaQ (yfaQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2226)

Predicted SEED Role

"FIG00638358: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76463 at UniProt or InterPro

Protein Sequence (549 amino acids)

>b2226 hypothetical protein (NCBI) (Escherichia coli BW25113)
MNWRRIVWLLALVTLPTLAEETPLQLVLRGAQHDQLYQLSSSGVTKVSALPDSLTTPLGS
LWKLYVYAWLEDTHQPEQPYQCRGNSPEEVYCCQAGESITRDTALVRSCGLYFAPQRLHI
GADVWGQYWQQRQAPAWLASLTTLKPETSVTVKSLLDSLATLPAQNKAQEVLLDVVLDEA
KIGVASMLGSRVRVKTWSWFADDKQEIRQGGFAGWLTDGTPLWVTGSGTSKTVLTRYATV
LNRVLPVPTQVASGQCVEVELFARYPLKKITAEKSTTAVNPGVLNGRYRVTFTNGNHITF
VSHGETTLLSEKGKLKLQSHLDREEYVARVLDREAKSTPPEAAKAMTVAIRTFLQQNANR
EGDCLTIPDSSATQRVSASPATTGARTMTAWTQDLIYAGDPVHYHGSRATEGTLSWRQAT
AQAGQGERYDQILAFAYPDNSLSRWGAPRSTCQLLPKAKAWLAKKMPQWRRILQAETGYN
EPDVFAVCRLVSGFPYTDRQQKRLFIRNFFTLQDRLDLTHEYLHLAFDGYPTGLDENYIE
TLTRQLLMD