Protein Info for b2220 in Escherichia coli BW25113

Name: atoC
Annotation: fused response regulator of ato operon, in two-component system with AtoS: response regulator/sigma54 interaction protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF00072: Response_reg" amino acids 7 to 115 (109 residues), 109.6 bits, see alignment E=3.3e-35 PF00158: Sigma54_activat" amino acids 145 to 311 (167 residues), 252.4 bits, see alignment E=6.2e-79 PF14532: Sigma54_activ_2" amino acids 146 to 316 (171 residues), 64.3 bits, see alignment E=5.5e-21 PF07728: AAA_5" amino acids 169 to 287 (119 residues), 27.5 bits, see alignment E=9.8e-10 PF00004: AAA" amino acids 169 to 287 (119 residues), 21.9 bits, see alignment E=7.5e-08 PF25601: AAA_lid_14" amino acids 317 to 393 (77 residues), 94.5 bits, see alignment E=9.8e-31 PF02954: HTH_8" amino acids 415 to 454 (40 residues), 52.7 bits, see alignment 1e-17

Best Hits

Swiss-Prot: 100% identical to ATOC_ECOLI: Regulatory protein AtoC (atoC) from Escherichia coli (strain K12)

KEGG orthology group: K07714, two-component system, NtrC family, response regulator AtoC (inferred from 100% identity to eco:b2220)

Predicted SEED Role

"Acetoacetate metabolism regulatory protein AtoC" in subsystem Acetyl-CoA fermentation to Butyrate or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q06065 at UniProt or InterPro

Protein Sequence (461 amino acids)

>b2220 fused response regulator of ato operon, in two-component system with AtoS: response regulator/sigma54 interaction protein (NCBI) (Escherichia coli BW25113)
MTAINRILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPE
MDGIKALKEMRSHETRTPVILMTAYAEVETAVEALRCGAFDYVIKPFDLDELNLIVQRAL
QLQSMKKEIRHLHQALSTSWQWGHILTNSPAMMDICKDTAKIALSQASVLISGESGTGKE
LIARAIHYNSRRAKGPFIKVNCAALPESLLESELFGHEKGAFTGAQTLRQGLFERANEGT
LLLDEIGEMPLVLQAKLLRILQEREFERIGGHQTIKVDIRIIAATNRDLQAMVKEGTFRE
DLFYRLNVIHLILPPLRDRREDISLLANHFLQKFSSENQRDIIDIDPMAMSLLTAWSWPG
NIRELSNVIERAVVMNSGPIIFSEDLPPQIRQPVCNAGEVKTAPVGERNLKEEIKRVEKR
IIMEVLEQQEGNRTRTALMLGISRRALMYKLQEYGIDPADV