Protein Info for b2211 in Escherichia coli BW25113

Name: yojI
Annotation: fused predicted multidrug transport subunits of ABC superfamily: membrane component/ATP-binding component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 55 to 80 (26 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details TIGR01194: cyclic peptide transporter" amino acids 2 to 527 (526 residues), 367.7 bits, see alignment E=5.2e-114 PF00005: ABC_tran" amino acids 341 to 477 (137 residues), 103.3 bits, see alignment E=1.7e-33

Best Hits

Swiss-Prot: 100% identical to YOJI_ECOLI: ABC transporter ATP-binding/permease protein YojI (yojI) from Escherichia coli (strain K12)

KEGG orthology group: K06159, putative ATP-binding cassette transporter (inferred from 100% identity to eco:b2211)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33941 at UniProt or InterPro

Protein Sequence (547 amino acids)

>b2211 fused predicted multidrug transport subunits of ABC superfamily: membrane component/ATP-binding component (NCBI) (Escherichia coli BW25113)
MELLVLVWRQYRWPFISVMALSLASAALGIGLIAFINQRLIETADTSLLVLPEFLGLLLL
LMAVTLGSQLALTTLGHHFVYRLRSEFIKRILDTHVERIEQLGSASLLAGLTSDVRNITI
AFVRLPELVQGIILTIGSAAYLWMLSGKMLLVTAIWMAITIWGGFVLVARVYKHMATLRE
TEDKLYTDFQTVLEGRKELTLNRERAEYVFNNLYIPDAQEYRHHIIRADTFHLSAVNWSN
IMMLGAIGLVFWMANSLGWADTNVAATYSLTLLFLRTPLLSAVGALPTLLTAQVAFNKLN
KFALAPFKAEFPRPQAFPNWQTLELRNVTFAYQDNAFSVGPINLTIKRGELLFLIGGNGS
GKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDYRKLFSAVFTDVWLFDQLLGPEGKPA
NPQLVEKWLAQLKMAHKLELSNGRIVNLKLSKGQKKRVALLLALAEERDIILLDEWAADQ
DPHFRREFYQVLLPLMQEMGKTIFAISHDDHYFIHADRLLEMRNGQLSELTGEERDAASR
DAVARTA