Protein Info for b2203 in Escherichia coli BW25113

Name: napB
Annotation: cytochrome c-type protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03892: NapB
  • amino acids 39 to 143 (105 residues), 149 bits, E=3.9e-48

Best Hits

Swiss-Prot: 100% identical to NAPB_ECOLI: Periplasmic nitrate reductase, electron transfer subunit (napB) from Escherichia coli (strain K12)

KEGG orthology group: K02568, cytochrome c-type protein NapB (inferred from 100% identity to eco:b2203)

MetaCyc: 100% identical to periplasmic nitrate reductase cytochrome c550 protein (Escherichia coli K-12 substr. MG1655)
Nitrate reductase (cytochrome). [EC: 1.9.6.1]

Predicted SEED Role

"Nitrate reductase cytochrome c550-type subunit" in subsystem Nitrate and nitrite ammonification

MetaCyc Pathways

• sn-glycerol 3-phosphate anaerobic respiration (3/3 steps found)
• nitrate reduction IV (dissimilatory) (2/2 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.9.6.1

Sequence Analysis Tools

See P0ABL3 at UniProt or InterPro

Protein Sequence (149 amino acids)

>b2203 cytochrome c-type protein (VIMSS) (Escherichia coli BW25113)
MKSHDLKKALCQWTAMLALVVSGAVWAANGVDFSQSPEVSGTQEGAIRMPKEQDRMPLNY
VNQPPMIPHSVEGYQVTTNTNRCLQCHGVESYRTTGAPRISPTHFMDSDGKVGAEVAPRR
YFCLQCHVPQADTAPIVGNTFTPSKGYGK