Protein Info for b2202 in Escherichia coli BW25113

Name: napC
Annotation: nitrate reductase, cytochrome c-type, periplasmic (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02161: periplasmic nitrate (or nitrite) reductase c-type cytochrome, NapC/NirT family
  • amino acids 11 to 194 (184 residues), 350.3 bits, E=1.3e-109
• PF03264: Cytochrom_NNT
  • amino acids 22 to 193 (172 residues), 272.2 bits, E=4.5e-85

Best Hits

Swiss-Prot: 100% identical to NAPC_ECO57: Cytochrome c-type protein NapC (napC) from Escherichia coli O157:H7

KEGG orthology group: K02569, cytochrome c-type protein NapC (inferred from 100% identity to eco:b2202)

MetaCyc: 54% identical to NapC (Aliivibrio fischeri)
RXN-15816 [EC: 7.1.1.8]

Predicted SEED Role

"Cytochrome c-type protein NapC" in subsystem Nitrate and nitrite ammonification or trimethylamine N-oxide (TMAO) reductase

MetaCyc Pathways

• sn-glycerol 3-phosphate anaerobic respiration (3/3 steps found)
• formate to nitrite electron transfer (2/3 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• Fe(II) oxidation (1/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.8

Sequence Analysis Tools

See P0ABL5 at UniProt or InterPro

Protein Sequence (200 amino acids)

>b2202 nitrate reductase, cytochrome c-type, periplasmic (NCBI) (Escherichia coli BW25113)
MGNSDRKPGLIKRLWKWWRTPSRLALGTLLLIGFVGGIVFWGGFNTGMEKANTEEFCISC
HEMRNTVYQEYMDSVHYNNRSGVRATCPDCHVPHEFVPKMIRKLKASKELYGKIFGVIDT
PQKFEAHRLTMAQNEWRRMKDNNSQECRNCHNFEYMDTTAQKSVAAKMHDQAVKDGQTCI
DCHKGIAHKLPDMREVEPGF