Protein Info for b2164 in Escherichia coli BW25113

Name: yeiM
Annotation: predicted nucleoside transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 50 (22 residues), see Phobius details amino acids 95 to 125 (31 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 283 to 283 (1 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details amino acids 321 to 338 (18 residues), see Phobius details amino acids 353 to 378 (26 residues), see Phobius details amino acids 391 to 414 (24 residues), see Phobius details TIGR00804: nucleoside transporter, NupC family" amino acids 4 to 412 (409 residues), 517.4 bits, see alignment E=1.5e-159 PF01773: Nucleos_tra2_N" amino acids 8 to 81 (74 residues), 82.2 bits, see alignment E=4.7e-27 PF07670: Gate" amino acids 98 to 196 (99 residues), 56.5 bits, see alignment E=5.2e-19 PF07662: Nucleos_tra2_C" amino acids 201 to 410 (210 residues), 240.3 bits, see alignment E=2.8e-75

Best Hits

Swiss-Prot: 100% identical to PSUT_ECOLI: Putative pseudouridine transporter (psuT) from Escherichia coli (strain K12)

KEGG orthology group: K03317, concentrative nucleoside transporter, CNT family (inferred from 100% identity to eco:b2164)

MetaCyc: 88% identical to putative nucleoside transporter (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Inner membrane transport protein YeiM, in cluster with pseudouridine metabolism operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33024 at UniProt or InterPro

Protein Sequence (416 amino acids)

>b2164 predicted nucleoside transporter (NCBI) (Escherichia coli BW25113)
MDIMRSVVGMVVLLAIAFLLSVNKKSISLRTVGAALLLQIAIGGIMLYFPPGKWAVEQAA
LGVHKVMSYSDAGSAFIFGSLVGPKMDVLFDGAGFIFAFRVLPAIIFVTALISLLYYIGV
MGLLIRILGSIFQKALNISKIESFVAVTTIFLGQNEIPAIVKPFIDRMNRNELFTAICSG
MASIAGSMMIGYAGMGVPIDYLLAASLMAIPGGILFARILSPATEPSQVTFENLSFSETP
PKSFIEAAASGAMTGLKIAAGVATVVMAFVAIIALINGIIGGIGGWFGFANASLESIFGY
VLAPLAWIMGVDWSDANLAGSLIGQKLAINEFVAYLSFSPYLQTGGTLEVKTIAIISFAL
CGFANFGSIGVVVGAFSAISPKRAPEIAQLGLRALAAATLSNLMSATIAGFFIGLA