Protein Info for b2158 in Escherichia coli BW25113

Name: yeiH
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 78 to 94 (17 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 134 to 151 (18 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details TIGR00698: conserved hypothetical protein" amino acids 14 to 348 (335 residues), 567.8 bits, see alignment E=4e-175 PF03601: Cons_hypoth698" amino acids 18 to 326 (309 residues), 405.7 bits, see alignment E=5.1e-126

Best Hits

Swiss-Prot: 100% identical to YEIH_ECOLI: UPF0324 inner membrane protein YeiH (yeiH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2158)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P62723 at UniProt or InterPro

Protein Sequence (349 amino acids)

>b2158 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MTNITLQKQHRTLWHFIPGLALSAVITGVALWGGSIPAVAGAGFSALTLAILLGMVLGNT
IYPHIWKSCDGGVLFAKQYLLRLGIILYGFRLTFSQIADVGISGIIIDVLTLSSTFLLAC
FLGQKVFGLDKHTSWLIGAGSSICGAAAVLATEPVVKAEASKVTVAVATVVIFGTVAIFL
YPAIYPLMSQWFSPETFGIYIGSTVHEVAQVVAAGHAISPDAENAAVISKMLRVMMLAPF
LILLAARVKQLSGANSGEKSKITIPWFAILFIVVAIFNSFHLLPQSVVNMLVTLDTFLLA
MAMAALGLTTHVSALKKAGAKPLLMALVLFAWLIVGGGAINYVIQSVIA