Protein Info for b2153 in Escherichia coli BW25113
Name: folE
Annotation: GTP cyclohydrolase I (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to GCH1_SHISS: GTP cyclohydrolase 1 (folE) from Shigella sonnei (strain Ss046)
KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 100% identity to eco:b2153)MetaCyc: 100% identical to GTP cyclohydrolase 1 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase I. [EC: 3.5.4.16]
Predicted SEED Role
"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)
MetaCyc Pathways
- superpathway of chorismate metabolism (54/59 steps found)
- superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
- superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (4/5 steps found)
- preQ0 biosynthesis (3/4 steps found)
- tetrahydromonapterin biosynthesis (3/4 steps found)
- drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
- erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
- threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.4.16
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P0A6T5 at UniProt or InterPro
Protein Sequence (222 amino acids)
>b2153 GTP cyclohydrolase I (NCBI) (Escherichia coli BW25113) MPSLSKEAALVHEALVARGLETPLRPPVHEMDNETRKSLIAGHMTEIMQLLNLDLADDSL METPHRIAKMYVDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVH YCVKARGIRDATSATTTTSLGGLFKSSQNTRHEFLRAVRHHN