Protein Info for b2151 in Escherichia coli BW25113

Name: galS
Annotation: DNA-binding transcriptional repressor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF00356: LacI" amino acids 3 to 48 (46 residues), 77.3 bits, see alignment 1.2e-25 PF00532: Peripla_BP_1" amino acids 60 to 274 (215 residues), 73.8 bits, see alignment E=3.4e-24 PF13407: Peripla_BP_4" amino acids 62 to 279 (218 residues), 69.5 bits, see alignment E=6.9e-23 PF13377: Peripla_BP_3" amino acids 169 to 329 (161 residues), 108.7 bits, see alignment E=7e-35

Best Hits

Swiss-Prot: 100% identical to GALS_ECOLI: HTH-type transcriptional regulator GalS (galS) from Escherichia coli (strain K12)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to eco:b2151)

Predicted SEED Role

"Mgl repressor and galactose ultrainduction factor GalS, HTH-type transcriptional regulator" in subsystem Lactose and Galactose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P25748 at UniProt or InterPro

Protein Sequence (346 amino acids)

>b2151 DNA-binding transcriptional repressor (NCBI) (Escherichia coli BW25113)
MITIRDVARQAGVSVATVSRVLNNSTLVSADTREAVMKAVSELDYRPNANAQALATQVSD
TIGVVVMDVSDAFFGALVKAVDLVAQQHQKYVLIGNSYHEAEKERHAIEVLIRQRCNALI
VHSKALSDDELAQFMDNIPGMVLINRVVPGYAHRCVCLDNLSGARMATRMLLNNGHQRIG
YLSSSHGIEDDAMRKAGWMSALKEQDIIPPESWIGAGTPDMPGGEAAMVELLGRNLQLTA
VFAYNDNMAAGALTALKDNGIAIPLHLSIIGFDDIPIARYTDPQLTTVRYPIASMAKLAT
ELALQGAAGNIDPRASHCFMPTLVRRHSVATRQNAAAITNSTNQAM