Protein Info for b2148 in Escherichia coli BW25113

Name: mglC
Annotation: beta-methylgalactoside transporter inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 102 to 130 (29 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 175 to 201 (27 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 268 to 299 (32 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 41 to 325 (285 residues), 161.4 bits, see alignment E=1.2e-51

Best Hits

Swiss-Prot: 100% identical to MGLC_ECOLI: Galactoside transport system permease protein MglC (mglC) from Escherichia coli (strain K12)

KEGG orthology group: K10541, methyl-galactoside transport system permease protein (inferred from 100% identity to eco:b2148)

MetaCyc: 100% identical to D-galactose/methyl-galactoside ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-18-RXN; TRANS-RXN0-541

Predicted SEED Role

"Galactose/methyl galactoside ABC transport system, permease protein MglC (TC 3.A.1.2.3)" in subsystem Lactose and Galactose Uptake and Utilization (TC 3.A.1.2.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P23200 at UniProt or InterPro

Protein Sequence (336 amino acids)

>b2148 beta-methylgalactoside transporter inner membrane component (NCBI) (Escherichia coli BW25113)
MSALNKKSFLTYLKEGGIYVVLLVLLAIIIFQDPTFLSLLNLSNILTQSSVRIIIALGVA
GLIVTQGTDLSAGRQVGLAAVVAATLLQSMDNANKVFPEMATMPIALVILIVCAIGAVIG
LINGLIIAYLNVTPFITTLGTMIIVYGINSLYYDFVGASPISGFDSGFSTFAQGFVALGS
FRLSYITFYALIAVAFVWVLWNKTRFGKNIFAIGGNPEAAKVSGVNVGLNLLMIYALSGV
FYAFGGMLEAGRIGSATNNLGFMYELDAIAACVVGGVSFSGGVGTVIGVVTGVIIFTVIN
YGLTYIGVNPYWQYIIKGAIIIFAVALDSLKYARKK