Protein Info for b2146 in Escherichia coli BW25113

Name: yeiT
Annotation: predicted oxidoreductase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 PF14691: Fer4_20" amino acids 7 to 113 (107 residues), 116.9 bits, see alignment E=2.1e-37 PF07992: Pyr_redox_2" amino acids 126 to 395 (270 residues), 89.1 bits, see alignment E=1.8e-28 PF01494: FAD_binding_3" amino acids 126 to 158 (33 residues), 22 bits, see alignment (E = 4.4e-08) PF00890: FAD_binding_2" amino acids 127 to 158 (32 residues), 20.6 bits, see alignment (E = 1.2e-07) PF13450: NAD_binding_8" amino acids 129 to 165 (37 residues), 37.6 bits, see alignment 1.1e-12 PF00070: Pyr_redox" amino acids 256 to 330 (75 residues), 35.7 bits, see alignment E=5.1e-12

Best Hits

Swiss-Prot: 100% identical to PRET_ECOLI: NAD-dependent dihydropyrimidine dehydrogenase subunit PreT (preT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2146)

MetaCyc: 100% identical to dihydropyrimidine dehydrogenase (NAD+) subunit PreT (Escherichia coli K-12 substr. MG1655)
Dihydrouracil dehydrogenase (NAD(+)). [EC: 1.3.1.1]; 1.3.1.1 [EC: 1.3.1.1]

Predicted SEED Role

"Pyridine nucleotide-disulphide oxidoreductase family protein"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76440 at UniProt or InterPro

Protein Sequence (412 amino acids)

>b2146 predicted oxidoreductase (NCBI) (Escherichia coli BW25113)
MPQQNYLDELTPAFTSLLAIKEASRCLLCHDAPCSQACPAQTDPGKFIRSIYFRNFKGAA
ETIRENNALGAVCARVCPTEKLCQSGCTRAGVDAPIDIGRLQRFVTDFEQQTGMEIYQPG
TKTLGKVAIIGAGPAGLQASVTLTNQGYDVTIYEKEAHPGGWLRNGIPQFRLPQSVLDAE
IARIEKMGVTIKCNNEVGNTLTLEQLKAENRAVLVTVGLSSGSGLPLFEHSDVEIAVDFL
QRARQAQGDISIPQSALIIGGGDVAMDVASTLKVLGCQAVTCVAREELDEFPASEKEFTS
ARELGVSIIDGFTPVAVEGNKVTFKHVRLSGELTMAADKIILAVGQHARLDAFAELEPQR
NTIKTQNYQTRDPQVFAAGDIVEGDKTVVYAVKTGKEAAEAIHHYLEGACSC