Protein Info for b2100 in Escherichia coli BW25113

Name: yegV
Annotation: predicted kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF00294: PfkB" amino acids 17 to 306 (290 residues), 194.4 bits, see alignment E=1.5e-61

Best Hits

Swiss-Prot: 100% identical to YEGV_ECOLI: Uncharacterized sugar kinase YegV (yegV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2100)

Predicted SEED Role

"Uncharacterized sugar kinase YegV, PfkB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76419 at UniProt or InterPro

Protein Sequence (321 amino acids)

>b2100 predicted kinase (NCBI) (Escherichia coli BW25113)
MSGARLHTLLPELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIA
VALKRLGIEAGNALPLGQGVWAEMIRNRMAKEGLISLIDNAEGDNGWCLALVEPDGERTF
MSFSGVENQWNRQWLARLTVAPGSLLYFSGYQLASPCGELLVEWLEELQDVTPFIDFGPR
IGDIPDALLARIMACRPLVSLNRQEAEIAAERFALSAEITTLGKQWQEKFAAPLIVRLDK
EGAWYFSNDASGCIPAFPTQVVDTIGAGDSHAGGVLAGLASGLPLADAVLLGNAVASWVV
GHRGGDCAPTREELLLAHKNV