Protein Info for b2096 in Escherichia coli BW25113

Name: gatY
Annotation: tagatose-bisphosphate aldolase 1 (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00167: ketose-bisphosphate aldolase
  • amino acids 1 to 284 (284 residues), 369.5 bits, E=1.3e-114
• TIGR01858: class II aldolase, tagatose bisphosphate family
  • amino acids 3 to 284 (282 residues), 539.8 bits, E=1.2e-166
• PF01116: F_bP_aldolase
  • amino acids 4 to 283 (280 residues), 343.9 bits, E=4e-107

Best Hits

Swiss-Prot: 100% identical to GATY_ECOLI: D-tagatose-1,6-bisphosphate aldolase subunit GatY (gatY) from Escherichia coli (strain K12)

KEGG orthology group: K08302, tagatose 1,6-diphosphate aldolase [EC: 4.1.2.40] (inferred from 100% identity to eco:b2096)

MetaCyc: 100% identical to tagatose-1,6-bisphosphate aldolase 2 (Escherichia coli K-12 substr. MG1655)
Tagatose-bisphosphate aldolase. [EC: 4.1.2.40]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of hexitol degradation (bacteria) (18/18 steps found)
• galactitol degradation (5/5 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (4/4 steps found)
• N-acetyl-D-galactosamine degradation (4/5 steps found)
• D-tagatose degradation (1/3 steps found)
• lactose degradation I (2/5 steps found)

KEGG Metabolic Maps

• Galactose metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.40

Use Curated BLAST to search for 4.1.2.40

Sequence Analysis Tools

See P0C8J6 at UniProt or InterPro

Protein Sequence (284 amino acids)

>b2096 tagatose-bisphosphate aldolase 1 (VIMSS) (Escherichia coli BW25113)
MYVVSTKQMLNNAQRGGYAVPAFNIHNLETMQVVVETAANLHAPVIIAGTPGTFTHAGTE
NLLALVSAMAKQYHHPLAIHLDHHTKFDDIAQKVRSGVRSVMIDASHLPFAQNISRVKEV
VDFCHRFDVSVEAELGQLGGQEDDVQVNEADALYTNPAQAREFAEATGIDSLAVAIGTAH
GMYASAPALDFSRLENIRQWVNLPLVLHGASGLSTKDIQQTIKLGICKINVATELKNAFS
QALKNYLTEHPEATDPRDYLQSAKSAMRDVVSKVIADCGCEGRA