Protein Info for b2092 in Escherichia coli BW25113

Name: gatC
Annotation: galactitol-specific enzyme IIC component of PTS (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 298 to 322 (25 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 417 to 435 (19 residues), see Phobius details PF03611: EIIC-GAT" amino acids 8 to 386 (379 residues), 298.4 bits, see alignment E=4.7e-93 TIGR00827: PTS system, galactitol-specific IIC component" amino acids 9 to 413 (405 residues), 711.1 bits, see alignment E=2e-218

Best Hits

Swiss-Prot: 100% identical to PTKC_ECO57: PTS system galactitol-specific EIIC component (gatC) from Escherichia coli O157:H7

KEGG orthology group: K02775, PTS system, galactitol-specific IIC component (inferred from 100% identity to eco:b2092)

MetaCyc: 100% identical to galactitol-specific PTS enzyme IIC component (Escherichia coli EC3132)
TRANS-RXN-161 [EC: 2.7.1.200]; TRANS-RXN-169 [EC: 2.7.1.200, 2.7.1.198]

Predicted SEED Role

"PTS system, galactitol-specific IIC component (EC 2.7.1.69)" in subsystem D-Tagatose and Galactitol Utilization (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.198 or 2.7.1.200 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P69831 at UniProt or InterPro

Protein Sequence (451 amino acids)

>b2092 galactitol-specific enzyme IIC component of PTS (NCBI) (Escherichia coli BW25113)
MFSEVMRYILDLGPTVMLPIVIIIFSKILGMKAGDCFKAGLHIGIGFVGIGLVIGLMLDS
IGPAAKAMAENFDLNLHVVDVGWPGSSPMTWASQIALVAIPIAILVNVAMLLTRMTRVVN
VDIWNIWHMTFTGALLHLATGSWMIGMAGVVIHAAFVYKLGDWFARDTRNFFELEGIAIP
HGTSAYMGPIAVLVDAIIEKIPGVNRIKFSADDIQRKFGPFGEPVTVGFVMGLIIGILAG
YDVKGVLQLAVKTAAVMLLMPRVIKPIMDGLTPIAKQARSRLQAKFGGQEFLIGLDPALL
LGHTAVVSASLIFIPLTILIAVCVPGNQVLPFGDLATIGFFVAMAVAVHRGNLFRTLISG
VIIMSITLWIATQTIGLHTQLAANAGALKAGGMVASMDQGGSPITWLLIQVFSPQNIPGF
IIIGAIYLTGIFMTWRRARGFIKQEKVVLAE