Protein Info for b2088 in Escherichia coli BW25113

Name: insE
Annotation: IS3 element protein InsE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 PF01527: HTH_Tnp_1" amino acids 11 to 78 (68 residues), 40 bits, see alignment E=1.9e-14

Best Hits

Swiss-Prot: 100% identical to INSE2_ECOLI: Transposase InsE for insertion sequence IS3B (insE2) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecd:ECDH10B_2242)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (99 amino acids)

>b2088 IS3 element protein InsE (RefSeq) (Escherichia coli BW25113)
MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSS
ERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK