Protein Info for b2086 in Escherichia coli BW25113

Name: yegS
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 TIGR00147: lipid kinase, YegS/Rv2252/BmrU family" amino acids 1 to 293 (293 residues), 416.5 bits, see alignment E=4.8e-129 TIGR03702: lipid kinase YegS" amino acids 7 to 298 (292 residues), 469 bits, see alignment E=5e-145 PF00781: DAGK_cat" amino acids 8 to 129 (122 residues), 97.8 bits, see alignment E=5.4e-32 PF19279: YegS_C" amino acids 150 to 288 (139 residues), 42.2 bits, see alignment E=1.1e-14

Best Hits

Swiss-Prot: 100% identical to YEGS_ECOBW: Probable lipid kinase YegS (yegS) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K07029, (no description) (inferred from 100% identity to eco:b2086)

MetaCyc: 100% identical to lipid kinase YegS (Escherichia coli K-12 substr. MG1655)
2.7.1.-

Predicted SEED Role

"Transcription regulator [contains diacylglycerol kinase catalytic domain]"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76407 at UniProt or InterPro

Protein Sequence (299 amino acids)

>b2086 hypothetical protein (NCBI) (Escherichia coli BW25113)
MAEFPASLLILNGKSTDNLPLREAIMLLREEGMTIHVRVTWEKGDAARYVEEARKFGVAT
VIAGGGDGTINEVSTALIQCEGDDIPALGILPLGTANDFATSVGIPEALDKALKLAIAGD
AIAIDMAQVNKQTCFINMATGGFGTRITTETPEKLKAALGSVSYIIHGLMRMDTLQPDRC
EIRGENFHWQGDALVIGIGNGRQAGGGQQLCPNALINDGLLQLRIFTGDEILPALVSTLK
SDEDNPNIIEGASSWFDIQAPHDITFNLDGEPLSGQNFHIEILPAALRCRLPPDCPLLR