Protein Info for b2074 in Escherichia coli BW25113

Name: b2074
Annotation: putative membrane protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 62 to 390 (329 residues), 260.7 bits, see alignment E=8.1e-82 PF16576: HlyD_D23" amino acids 85 to 309 (225 residues), 43.2 bits, see alignment E=5.7e-15 PF13533: Biotin_lipoyl_2" amino acids 87 to 135 (49 residues), 55.4 bits, see alignment 8.3e-19 PF13437: HlyD_3" amino acids 198 to 301 (104 residues), 34 bits, see alignment E=8.3e-12

Best Hits

Swiss-Prot: 100% identical to MDTA_ECO27: Multidrug resistance protein MdtA (mdtA) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 100% identity to eco:b2074)

MetaCyc: 100% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76397 at UniProt or InterPro

Protein Sequence (415 amino acids)

>b2074 putative membrane protein (VIMSS) (Escherichia coli BW25113)
MKGSYKSRWVIVIVVVIAAIAAFWFWQGRNDSRSAAPGATKQAQQSPAGGRRGMRSGPLA
PVQAATAVEQAVPRYLTGLGTITAANTVTVRSRVDGQLIALHFQEGQQVKAGDLLAEIDP
SQFKVALAQAQGQLAKDKATLANARRDLARYQQLAKTNLVSRQELDAQQALVSETEGTIK
ADEASVASAQLQLDWSRITAPVDGRVGLKQVDVGNQISSGDTTGIVVITQTHPIDLVFTL
PESDIATVVQAQKAGKPLVVEAWDRTNSKKLSEGTLLSLDNQIDATTGTIKVKARFNNQD
DALFPNQFVNARMLVDTEQNAVVIPTAALQMGNEGHFVWVLNSENKVSKHLVTPGIQDSQ
KVVIRAGISAGDRVVTDGIDRLTEGAKVEVVEAQSATTPEEKATSREYAKKGARS