Protein Info for b2052 in Escherichia coli BW25113

Name: fcl
Annotation: bifunctional GDP-fucose synthetase: GDP-4-dehydro-6-deoxy-D-mannose epimerase/ GDP-4-dehydro-6-L-deoxygalactose reductase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF01370: Epimerase" amino acids 6 to 227 (222 residues), 215.8 bits, see alignment E=9.5e-68 PF16363: GDP_Man_Dehyd" amino acids 39 to 307 (269 residues), 65.1 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 100% identical to FCL_ECOLI: GDP-L-fucose synthase (fcl) from Escherichia coli (strain K12)

KEGG orthology group: K02377, GDP-L-fucose synthase [EC: 1.1.1.271] (inferred from 100% identity to eco:b2052)

MetaCyc: 100% identical to GDP-L-fucose synthase (Escherichia coli K-12 substr. MG1655)
GDP-L-fucose synthase. [EC: 1.1.1.271]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.271

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32055 at UniProt or InterPro

Protein Sequence (321 amino acids)

>b2052 bifunctional GDP-fucose synthetase: GDP-4-dehydro-6-deoxy-D-mannose epimerase/ GDP-4-dehydro-6-L-deoxygalactose reductase (NCBI) (Escherichia coli BW25113)
MSKQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVY
LAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMA
ESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHV
IPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPML
SHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEIS
LEAGLASTYQWFLENQDRFRG