Protein Info for b2040 in Escherichia coli BW25113

Name: rfbD
Annotation: dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of dTDP-L-rhamnose synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF04321: RmlD_sub_bind" amino acids 1 to 293 (293 residues), 364.1 bits, see alignment E=1.1e-112 PF01370: Epimerase" amino acids 3 to 179 (177 residues), 62.5 bits, see alignment E=1.1e-20 TIGR01214: dTDP-4-dehydrorhamnose reductase" amino acids 3 to 292 (290 residues), 327.7 bits, see alignment E=2.6e-102 PF02719: Polysacc_synt_2" amino acids 3 to 154 (152 residues), 29.9 bits, see alignment E=8.2e-11 PF16363: GDP_Man_Dehyd" amino acids 38 to 151 (114 residues), 43.9 bits, see alignment E=5.7e-15 PF07993: NAD_binding_4" amino acids 55 to 156 (102 residues), 21.9 bits, see alignment E=2.2e-08

Best Hits

Swiss-Prot: 100% identical to RMLD_ECOLI: dTDP-4-dehydrorhamnose reductase (rfbD) from Escherichia coli (strain K12)

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 100% identity to eco:b2040)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37760 at UniProt or InterPro

Protein Sequence (299 amino acids)

>b2040 dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of dTDP-L-rhamnose synthase (NCBI) (Escherichia coli BW25113)
MNILLFGKTGQVGWELQRALAPLGNLIAFDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN
AAAHTAVDKAESEPEFAQLINATSVEAIAKAANEVGAWVIHYSTDYVFPGNGDMPWLETD
ATAPLNVYGETKLAGEKALQEYCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN
DQFGAPTGAELLADCTAHAIRVALNKPDVAGLYHLVASGTTTWYDYAALVFEEARKAGIP
LALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRMLNELFTTTAI