Protein Info for b2025 in Escherichia coli BW25113

Name: hisF
Annotation: imidazole glycerol phosphate synthase subunit HisF (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 1 to 256 (256 residues), 392.8 bits, E=2.9e-122
• PF00977: His_biosynth
  • amino acids 5 to 239 (235 residues), 257.6 bits, E=9.4e-81

Best Hits

Swiss-Prot: 100% identical to HIS6_ECOLI: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Escherichia coli (strain K12)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 100% identity to eco:b2025)

MetaCyc: 100% identical to imidazole glycerol phosphate synthase subunit HisF (Escherichia coli K-12 substr. MG1655)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.- or 4.3.2.10

Sequence Analysis Tools

See P60664 at UniProt or InterPro

Protein Sequence (258 amino acids)

>b2025 imidazole glycerol phosphate synthase subunit HisF (NCBI) (Escherichia coli BW25113)
MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRV
VDKSWVSRVAEVIDIPFCVAGGIKSLEDAAKILSFGADKISINSPALADPTLITRLADRF
GVQCIVVGIDTWYDAETGKYHVNQYTGDESRTRVTQWETLDWVQEVQKRGAGEIVLNMMN
QDGVRNGYDLEQLKKVREVCHVPLIASGGAGTMEHFLEAFRDADVDGALAASVFHKQIIN
IGELKAYLATQGVEIRIC